PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca23515.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family TALE
Protein Properties Length: 425aa    MW: 47066.6 Da    PI: 8.9889
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca23515.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox30.18.2e-102753052454
                 S--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
    Homeobox  24 ypsaeereeLAkklgLterqVkvWFqNrRak 54 
                 yps ++++ LA+k+gL+ +qV++WF N R +
  Dca23515.1 275 YPSDTDKQMLAQKTGLSRSQVSNWFTNARVR 305
                 9****************************98 PP

2BELL81.79.6e-271442051172
        BELL  11 kLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                  L+s+l+eV+++Yk y++q+q  + sFe vaglg+a+p++s+A +a+ rhF cLk+ai +qi
  Dca23515.1 144 NLVSMLHEVYRKYKLYCQQMQSAVTSFESVAGLGNAAPFISFAVRAMFRHFHCLKNAILDQI 205
                 69**********************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005745.1E-2477203IPR006563POX domain
PfamPF075266.9E-2682201IPR006563POX domain
Gene3DG3DSA:3.30.9.103.6E-498107No hitNo description
CDDcd000862.11E-11256310No hitNo description
SMARTSM003895.7E-9256313IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.607.1E-20259309IPR009057Homeodomain-like
SuperFamilySSF466891.03E-12259315IPR009057Homeodomain-like
PfamPF059201.4E-12275305IPR008422Homeobox KN domain
PROSITE profilePS5007111.24275309IPR001356Homeobox domain
Gene3DG3DSA:3.30.9.103.6E-4310395No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 425 aa     Download sequence    Send to blast
MDDSFHVPQQ NRRHKLRYLT VPHHDSSTSS AAVLHHSLLA TSPATSALNL SLSTHARTAG  60
AYSSSSAAAA APVGPFTGYA SILARSRFLR PAQDLLDAFS AADGGVVAAV SSPSAAAKRI  120
LEESGGLFSD DDEVVISRRC TNPNLVSMLH EVYRKYKLYC QQMQSAVTSF ESVAGLGNAA  180
PFISFAVRAM FRHFHCLKNA ILDQIRVSSK GFGSGEDCRR ERDLGSCPDD KSPYDPKQNM  240
GQDHGSGANF LQHPVWRSQR GFPDKAVAVL RTWLYPSDTD KQMLAQKTGL SRSQVSNWFT  300
NARVRLWKPM VEEIHTLERK AQCSKATNTP PFINLSSSDT SLHPQLTEQD FEIVNHRRNH  360
ESHSKRTRTE ADPRAEQSKE HFSLLSTHSI PGIDSHQIDL SHQQNTSGIS WPPQGQILPF  420
WLARQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010687910.11e-156PREDICTED: BEL1-like homeodomain protein 9
TrEMBLA0A0K9RBJ41e-157A0A0K9RBJ4_SPIOL; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02030.11e-58TALE family protein